×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: dadstar warsfireflyminecraftgamesgamingweaponbachelordrinkingparks and recreation

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details

Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details


IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details

Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details

Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details



The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details

Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Das Boot

Das Boot.

$34.99Details

Cuponk Boomshakalaka

Sink your ball into the cup and light it up. Get it in and you'll hear the sweet sounds of victory.

$19.77Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details


PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details

Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details


Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details

8 Bit Tie

A reminder of better days.

$14.99Details


Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details

Official Barney Stinson Armani Grey Suitjamas

A salute to the perfect gentlemen. Never not wear a suit again!

$99.99Details


Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details

12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details


Gear Wall Art with Clock

Perfect for the mechanically inclined person in your life. Perfectly balanced between art and utility.

$140.00Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details


MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

Ninja Coat Hook

Hang up your coat Yakuza style! This Ninja Coat Hook will transform your entry way into a dangerous Tokyo alley.

$9.11Details


Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details


Operation Star Wars Edition

R2D is on the blink and looking for a steady hand to help. Can you repair a cranky crankshaft or a hiccupping hologram?

$26.93Details

Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details


Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details

Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details

Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details


Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details

10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details


Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Star Wars Chewbacca Back Buddy Plush

Now Chewy can join you everywhere you go.

$45.00Details


Glow in the Dark Toilet Roll

Don't like turning the light on when you need an impromptu midnight wee? Your aim may be rubbish, but at least you can find the toilet paper thanks to our Glow in the Dark Toilet Roll!

$7.60Details


Marini's Candies Chocolate Covered Bacon 1/2 lb. Gift Box

Hickory smoked bacon is cooked in the oven until golden & crisp then it's smothered in milk chocolate.

$12.95Details

Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details


Dynaflex Iron Power Force 1 - Silver, Metal Powerball

The Iron Power Force One Gyro creates up to 16,000 rpm and 50 pounds of silky-smooth dynamic resistance in the palm of your hand.

$99.89Details

Nerf N-Force Marauder Long Sword - Black

A sword designed for full contact fighting.

$38.77Details


Fish Eyes Rod and Reel with Underwater Video Camera

Underwater camera lets you watch what's happening on the line.

$59.99Details

Pool Table, Tabletop

Mini pool table.

$39.95Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details

iRobot Remote Controlled Cordless Electric Gutter Cleaning Robot

Looj blasts through debris, clogs and sludge and brushes your gutters clean. Stop repeated ladder repositioning and over reaching from dangerous heights.

$129.99Details


Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details

Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Kikkerland UL01 Electro Man 4-Plug Multi-Outlet

Meet a powerful man who is more than a boring power outlet. Perfect for home, school or office, his legs and arms have three-prong sockets with enough room even for the biggest adapter.

$21.00Details

Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details


Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details

Pillow Remote Control

Never again will you have to ask, "wheres the remote" And youll never lose this remote in between the cushions. Because it IS a cushion.

$39.99Details


Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details

Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details


Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details

The Golf Club Incrediball RTR RC Remote Control Golfball (Color May Vary)

A remote controlled golf ball that can be set to spin off in any direction you fancy at the flick of a switch.

$17.99Details


Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details

Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details


Got Wood?

T-Shirt (Also available as Hoodie)

$24.54Details

Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details


Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details

Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details


Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details

Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details


Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details

The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details


Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details

3D Pig from Minecraft

Oink! Oink!

$20.00Details


Carhartt Men's Thermal Lined Duck Active Jacket, Brown, Large Regular

Work proven, our duck active jacket is built with 12-ounce, firm-hand, 100% ring-spun cotton duck with a 100% polyester thermal lining for on-the-job warmth.

$69.99Details

Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details



Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details

Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details

Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details


Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details

Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details


Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details

Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details


Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details

Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details


Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details

iRobot 530 Roomba Vacuuming Robot, White

This specific Roomba model systematically cleans up to three* rooms on a single charge and gets into hard-to-reach wall edges and beneath furniture, while avoiding stairs and other drop-offs.

$249.99Details


Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details

Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details


Eat Sleep Minecraft T-Shirt

Eat, Sleep Minecraft

$23.52Details

Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details


Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details


MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details

Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details

World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details


Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details

BACON shaped themed Adhesive Bandages

Bacon Band Aids. Bacon really does fix everything.

$6.99Details


Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details

Harvil Tabletop Air Hockey Table

The Harvil Tabletop Air Hockey Table is a lightweight and affordable way to introduce the fun of air hockey to children.

$149.44Details


Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details

Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details


Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details

Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details


Clocky Alarm Clock on Wheels, Almond

This alarm clock runs away from you to make sure you get out of bed.

$49.99Details

Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details




Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details

Serenity Firefly Crime To Be Done Mal T-shirt

Got us some crime to be done.

$17.95Details


Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details


(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details


Firefly Poster TV 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly Reproduction Poster Print Style A 11 x 17 Inches -28cm x 44cm

$19.99Details

Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details



DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details

Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details


Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details

Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details


Longclaw, Sword of Jon Snow. Licensed from George R.R. Martin's "A Game of Thrones"

For five centuries the Valyrian steel sword Longclaw was carried by the Lords of Bear Island in the service of the Starks of Winterfell.

$249.95Details

Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details


Needle, Sword of Arya Stark. Licensed from George R.R. Martin's "A Song of Ice and Fire."

Lighter, thinner, and smaller than a typical Westeros blade, the style was closer to that of Braavos across the Narrow Sea, to be used for thusting and slashing, style of combat more suited to the quick and agile, rather than those with raw strength.

$199.95Details

Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details


King Robert's Warhammer

Rhaegar fought valiantly, Rhaegar fought nobly, Rhaegar fought honorably. And Rhaegar died.

$270.00Details

Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details


Ice, Sword of Eddard Stark, Damascus Edition

If you would take a man's life, you owe it to him to look into his eyes and hear his final words. And if you can not do that, then perhaps the man does not deserve to die.

$700.00Details

Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details


Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details

Firefly Serenity in Flight Bumper Sticker

A Boat in the Air We Can All Love

$7.63Details



Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details

Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details


Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details

Quantum Mechanix Serenity: Big Damn Heroes: River Tam Maquette

Serenity's psychotic killing machine River Tam

$49.98Details


Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details

Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details


Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details

Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details


Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details


Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24) Poster Print, 34x22

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24)

$2.82Details

Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details


Star Wars Clone Wars Comforter - Twin

Star Wars Clone Wars Comforter.

$34.83Details

The Mountain Three Wolf Moon Short Sleeve Tee

This shirt needs no description.

$35.00Details



Star Wars: The Complete Visual Dictionary - The Ultimate Guide to Characters and Creatures from the Entire Star Wars Saga

Provides a complete, comprehensive overview of the Prequel movies (Episodes I-III) and the Trilogy (Episodes IV-VI), this is the definitive photographic guide to the entire Star Wars saga.

$26.40Details


Boba Fett Star Wars Hat

Now you too can be digested by the Sarlac Pit Monster!

$49.99Details

Boba Grafetti baby tee

You should wait for the paint on your helmet to dry before launching head first into a sail barge, it may leave a nasty imprint of your defeat.

$18.95Details


Star Wars Bath Playset

Includes R2D2, C3PO, Yoda, Darth Vader, Boba Fett, Stormtrooper, and Chewbacca

$35.99Details

Evolution of Evil T-Shirt

There has been a disturbance in the force, and it ain't good.

$19.95Details


Star Wars - Movie Poster (Darth Vader: Your Empire Needs You) (Size: 24" x 36")

Star Wars Movie Your Empire Needs You Darth Vader Poster Print - 24x36

$7.99Details

Ackbarpography t-shirt

Take a closer look and you'll discover the holy grail of science fiction one-liners... IT'S A TRAP!

$19.95Details


Stormtroopa t-shirt

When someone always rescues the princess, when a short stumpy plumber can dismantle an entire evil empire, when all the giant bombs and bullets of the world just aren't enough - it's time to consider the benefits of mass-production!

$19.95Details


Peek into the Dark Side t-shirt

What would you do with the power? We feel a breeze in the Force.

$19.95Details

(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details


Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details

Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details


Star Wars: The Clone Wars - The Complete Season One

This new TV series takes place immediately after the events of Star Wars-Episode II: Attack of the Clones.

$44.98Details

Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details


Fanboys

Get ready for the comedy adventure that's "smart, funny, and tailor-made for the inner-Jedi in all of us"

$6.49Details


Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details

Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details


Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details

Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details


Lego Star Wars: The Complete Saga

Play through the events of all 6 Star Wars movies in 1 videogame for the first time ever.

$17.29Details


RoomMates RMK1382SCS Star Wars: The Clone Wars Glow in the Dark Wall Decals

All the light sabers glow in the dark, need I say more?

$9.97Details

Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

Meon Star Wars - Interactive Animation Studio

Make your own Star Wars animated signs that light up like Neon.

$11.99Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details

Revell Star Wars -Millennium Falcon

Perhaps the most iconic starship in the universe.

$35.61Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

LEGO Kids' 9002113 Star Wars Darth Vader Mini-Figure Alarm Clock

This LEGO Darth Vader clock is a must-have addition to the night table, dorm room or executive desk of any Star Wars fan.

$29.99Details


Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details

LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details


Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

Treat Yo Self triangle necklace

Velvet slippies, cashmere socks, velvet pants, cashmere turtle. I'm a cashmere velvet candy cane

$30.00Details



Framed Star Wars YODA best quotes text print

This is a limited edition TEXT art piece. The image is made up entirely of colored text.

$19.99Details


Handmade Star Wars Chewbacca Stuffed Plush Animal

Carry Chewie where ever you go! 20 inches tall with cute button eyes and a cute button nose! Handmade out of the softest fluffiest brown fur availabel! Comes with bandolier.

$28.00Details

Parks and Recreation Li'l Sebastian T-Shirt, Large

I Met Li'l Sebastian at the Pawnee harvest festival.

$26.00Details


Uncle Milton Lightsaber Room Light

Construct your own Jedi lightsaber and mount your creation as a room light on the wall. Eight color effects let kids personalize their lightsaber, and a wireless remote control turns the light on and off.

$24.99Details

Parks and Recreation Mouse Rat T-Shirt, Medium

Mouse Rat or was it Threeskin?

$26.00Details


Kotobukiya Star Wars: Han Solo in Carbonite Silicon Tray

Freeze your own Han Solo! Here comes an innovative Star Wars kitchen product from a galaxy far, far away. This time around, the fun gets frosty with the Han Solo in Carbonite Silicone Tray.

$8.89Details


Uncle Milton Star Wars Science Death Star Planetarium

This table top Death Star opens up into a planetary projector to display the cosmos on your bedroom ceiling.

$19.88Details

Parks and Recreation Trippin' Tammy T-Shirt, Medium

Quite possibly the most awesome shirt in existence.

$26.00Details


Star Wars Ultimate Darth Vader FX Lightsaber

Act just like Darth Vader with the Darth Vader Star Wars Ultimate FX Lightsaber, a glowing, humming, clashing Lightsaber that looks and feels just like the real thing.

$38.99Details

Parks And Recreation Poster 24x36in

Poster of the awesome cast of Parks and Rec

$19.97Details


Underground Toys Star Wars 9" Talking Plush - Chewbacca

This Classic talking Star Wars recreation of absolutely everyone's favorite Wookie, is incredibly cute and life like!

$25.08Details


Star Wars Deluxe Set of 6 Movie Posters From ALL the Star Wars Movies

6 STAR WARS MOVIE POSTERS on Quality Stock Paper One full size movie poster from each Star Wars Episode.

$32.99Details

Underground Toys Star Wars 9" Talking Plush - R2-D2

Why not take a load off and cuddle up with this wonderful, talking, soft plushes while war rages on between the Empire and the Rebel forces!

$22.34Details


Star Wars Darth Vader Helmet

Are you ready to feel like the villain to end all villains This detailed DARTH VADER electronic helmet will make the action feel incredibly real!

$19.97Details


Star Wars "Men of Distinction" set of two 11x17 prints (Darth Vader & Boba Fett), unframed

Have you ever wished for Star Wars-related art with class and distinction? Look no further; this dark lord and bounty hunter duo knows how to settle things like true gentlemen.

$20.00Details


Star Wars 10 oz Glasses, Set of 4

1 each of Princess Leia, Darth Vader, Luke Skywalker, and Han Salo

$25.00Details


Vandor 18-Ounce Ceramic Mug, Star Wars Yoda

You don't need to travel to a galaxy far, far away to find your favorite classic Star Wars characters.

$19.26Details


Custom HAND Painted Heels - Star Wars

THE VERY BEST CUSTOM STAR WARS HEELS YOU WILL FIND!

$275.00Details


Kurt Adler SW6101L Star Wars Nutcracker, Storm Trooper, 11-Inch

This 11-inch nutcracker is based on a Storm Trooper from the popular Star Wars series.

$35.67Details

Star Wars Art Prints Boba Fett R2D2 and C-3PO Art 3D Pop Artwork Droid Art

This Star Wars Art prints listing is for paper cut 3-D pop artwork featuring the galaxy's favorite bounty hunter Boba Fett and inter-galactic best buddies: R2-D2 and C-3PO.

$67.00Details


LEGO Star Wars Millennium Falcon 7965

Straight from the Death Star escape scene of Episode IV: A New Hope

$126.99Details


Stormtrooper Regrets T-Shirt

Those WERE The Droids You Were Looking For

$16.99Details

Star Wars Science - Force Trainer

May the Force be with you! The Force Trainer by Uncle Milton actually allows you to control a Jedi Training Remote with your mind, by tapping into cutting-edge brainwave technology.

$35.95Details


Star Wars Dinnerware Plate and Bowl - 2 Piece Set

Package includes 1 plate and 1 bowl Plate size 8 inches in diameter, bowl size is 5.75 inches in diameter.

$4.51Details

Funko Darth Vader Bobble - Head

This mighty warrior will watch over your desk and enforce the emperor's will on all who dare draw near.

$10.07Details


Vandor 14 by 4 by 15-Inch Star Wars Large Recycled Shopper Tote, Multicolored

The Star Wars Large Recycled Tote is the perfect gift for any Star Wars fan.

$5.95Details

STAR WARS DOG hat costume yoda

Show your love of awesome things by dressing your furry monster up as Yoda this year!

$20.00Details


Flared Star Wars Skirt

One of a kind Skirt. Flared Style. With Knit Waistband. M Waist 30-38

$25.00Details

Adult R2-D2 Star Wars Beanie

Crocheted R2-D2 beanie hat for teens and adults.

$42.00Details


Star Wars Cupcake Stencils

Our set includes Star Wars logo, Darth Vader, Yoda and a Stormtrooper

$19.99Details

Parks and Recreation Mouse Rat Zippo Lighter

Required gear for any Mouse Rat concert.

$29.95Details


Parks and Recreation Fourth in Obesity T-Shirt, Large

First in Friendship, Fourth in Obesity.

$26.00Details

SWANSON PYRAMID T-Shirt

Ron Swanson Pyramid of Greatness t-shirt!

$16.99Details


Entertainment 720 Shirt, With Jean-Ralphio T-Shirt

Sip on some snakejuice and show your love for television's Parks and Recreation and Entertainment 720 while wearing this screen printed grey 90% cotton shirt.

$14.00Details

Ron Swanson Bacon & Eggs Shirt in Cream

With eggs for eyes and a bacon 'stache, Ron Swanson is illustrated with two of his favorite foods in my original design.

$22.00Details


Meat Tornado Poster

Quote from one of the manliest characters in history, Mr. Ron Swanson himself.

$16.50Details

Ron Swanson Fishing Poster

Fish ain't no bacon.

$16.50Details


Woman Of The Year Juniors T-Shirt

Woman of the Year - Ron Swanson

$23.95Details

Ultra-Star 175G Ultimate Disc

The world standard for the sport of Ultimate, and the official disc of the USA Ultimate Championship Series.

$5.95Details



Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details

Star Wars X Wing Pilot Hoodie

This Star Wars X-Wing Pilot Hoodie is specifically customized to reflect Luke Skywalker's jumpsuit, visor and specific helmet designs.

$150.00Details


© Gift Lizard 2011